PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_009623-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 110aa    MW: 13322.2 Da    PI: 9.9416
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_009623-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-182475556
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +++ e +++Le++Fe++++++ e++ ++Ak++gL+ rqV +WFqNrRa+++
  AHYPO_009623-RA 24 NRLSIEKVKALEKHFEEENKLQPERKMKIAKEVGLEPRQVAIWFQNRRARWR 75
                     55788999*******************************************9 PP

2HD-ZIP_I/II114.56.5e-3722109289
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                      kk rls e+vk+LE++Feee+kL+perK+++a+e+gl+prqva+WFqnrRAR++tk+lEk+y++L+++ydalk +  +L++++ +L +
  AHYPO_009623-RA  22 KKNRLSIEKVKALEKHFEEENKLQPERKMKIAKEVGLEPRQVAIWFQNRRARWRTKHLEKEYDHLRANYDALKLNYGSLQQQKCSLLQ 109
                      9*********************************************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.6331777IPR001356Homeobox domain
SMARTSM003893.3E-141981IPR001356Homeobox domain
SuperFamilySSF466896.27E-182189IPR009057Homeodomain-like
CDDcd000863.99E-112278No hitNo description
PfamPF000466.2E-162475IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.1E-192584IPR009057Homeodomain-like
PRINTSPR000311.8E-54857IPR000047Helix-turn-helix motif
PROSITE patternPS0002705275IPR017970Homeobox, conserved site
PRINTSPR000311.8E-55773IPR000047Helix-turn-helix motif
PfamPF021834.2E-977110IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MSAQKERIEE EDNEEKNGQI MKKNRLSIEK VKALEKHFEE ENKLQPERKM KIAKEVGLEP  60
RQVAIWFQNR RARWRTKHLE KEYDHLRANY DALKLNYGSL QQQKCSLLQQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675091.12e-49PREDICTED: homeobox-leucine zipper protein ATHB-16-like
SwissprotP466671e-35ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5
TrEMBLA0A0J8CN112e-49A0A0J8CN11_BETVU; Uncharacterized protein
STRINGVIT_18s0001g06430.t017e-38(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.22e-33homeobox protein 5